DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ppih

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_989366.1 Gene:ppih / 394997 XenbaseID:XB-GENE-485863 Length:177 Species:Xenopus tropicalis


Alignment Length:171 Identity:134/171 - (78%)
Similarity:153/171 - (89%) Gaps:0/171 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKD 77
            ::|||:|||||::|..|:|||..|||||.||:||||||||||||:|.|||||||||::|||||||
 Frog     7 NANNPIVFFDISIGGQEVGRMKVELFADIVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKD 71

  Fly    78 FMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDG 142
            |||||||||.||||||.|||...|.||||..||.:||||||||||..||||||||||:||::|||
 Frog    72 FMIQGGDFVNGDGTGVASIYRGPFADENFKQKHSTPGLLSMANSGPGTNGCQFFITCSKCDWLDG 136

  Fly   143 KHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||||||:|:||||:|||||||||||||||||||.|:|||:|
 Frog   137 KHVVFGKVIDGLLVMRKIENVPTGPNNKPKLPVVIAQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 129/163 (79%)
ppihNP_989366.1 cyclophilin 5..177 CDD:381853 133/169 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 270 1.000 Domainoid score I1809
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H38172
Inparanoid 1 1.050 294 1.000 Inparanoid score I2715
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0005876
OrthoInspector 1 1.000 - - oto104904
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R962
SonicParanoid 1 1.000 - - X4270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.090

Return to query results.
Submit another query.