DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CG8336

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001261636.1 Gene:CG8336 / 39121 FlyBaseID:FBgn0036020 Length:383 Species:Drosophila melanogaster


Alignment Length:173 Identity:83/173 - (47%)
Similarity:111/173 - (64%) Gaps:4/173 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIK 76
            |.||:|:.||::|..:.||||.||..|.||:||||||..||||  ....|.|:.|||..||::.:
  Fly    12 STNPLVYLDISIGKEDAGRMIIELRKDVVPKTAENFRALCTGECGIGTLGKPLHYKGTKFHKIKR 76

  Fly    77 DFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGK-ETNGCQFFITCAKCNFL 140
            .|::|.||.|:.||:...||||..|.||||.|.|:..|::||||.|| .:|..||||:.|.|..|
  Fly    77 VFVVQSGDVVKNDGSSGESIYGPVFDDENFELSHNEEGVVSMANYGKPNSNNSQFFISAAGCENL 141

  Fly   141 DGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            :|.:||.||||.||.|:.::|...|...: |..|:.|..||::
  Fly   142 NGTNVVVGRVLRGLGIVAEMEQNCTDEGD-PTAPIVIRDCGEI 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 79/166 (48%)
CG8336NP_001261636.1 cyclophilin 15..181 CDD:294131 79/166 (48%)
TPR repeat 285..315 CDD:276809
TPR_19 300..369 CDD:291240
TPR_1 320..353 CDD:278916
TPR repeat 320..346 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447204
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.