DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CG3511

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001286847.1 Gene:CG3511 / 37926 FlyBaseID:FBgn0035027 Length:637 Species:Drosophila melanogaster


Alignment Length:155 Identity:68/155 - (43%)
Similarity:87/155 - (56%) Gaps:12/155 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGG 83
            ::.::.:.||: |.:...||...||:|.|||.......|        |.|..||||||.||:|.|
  Fly   480 IYENVVLHTTK-GDIHMRLFFKEVPKTVENFCVHAKNGY--------YNGHIFHRVIKGFMVQTG 535

  Fly    84 DFVQGDGTGVTSIYGNTFGDENF-TLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVF 147
            | ..|.|||..||:|:.|.||.. :||||.|..:||||:|..|||.|||||.....:||.||.||
  Fly   536 D-PTGTGTGGKSIWGSDFKDEFVPSLKHDRPYTVSMANAGPNTNGSQFFITVLPTPWLDNKHTVF 599

  Fly   148 GRVLDGLLIMRKIENVPTGP-NNKP 171
            |||..|:.::..|.|....| .:||
  Fly   600 GRVYRGMEVVLNICNSKANPKTDKP 624

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 68/155 (44%)
CG3511NP_001286847.1 WD40 <75..>312 CDD:225201
WD40 <79..300 CDD:295369
WD40 repeat 85..122 CDD:293791
WD40 repeat 128..176 CDD:293791
WD40 repeat 181..210 CDD:293791
WD40 repeat 218..268 CDD:293791
WD40 repeat 275..311 CDD:293791
cyclophilin_WD40 485..633 CDD:238908 68/150 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447243
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.