DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and cyp33

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_523773.1 Gene:cyp33 / 36984 FlyBaseID:FBgn0028382 Length:300 Species:Drosophila melanogaster


Alignment Length:168 Identity:91/168 - (54%)
Similarity:110/168 - (65%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80
            ||.|||||.:|..:.||::..|.||.||:|||||||.||.|.     ..||||.||||||.:||.
  Fly   138 NPQVFFDIRIGGNDAGRIVMLLRADVVPKTAENFRQLCTHEQ-----GYGYKGCSFHRVIPEFMC 197

  Fly    81 QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            |||||...:|||..||||..|.||||.|||:|.|.|||||||..|||.||||...|.::||.|||
  Fly   198 QGGDFTNNNGTGGKSIYGKKFNDENFNLKHNSFGTLSMANSGANTNGSQFFICTTKTDWLDNKHV 262

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||.|:.|..::||:|...: .:..|...:.|..||::
  Fly   263 VFGHVISGAEVVRKMERCGS-KSGTPSQKIVIYSCGEL 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 88/163 (54%)
cyp33NP_523773.1 RRM_PPIE 8..80 CDD:240793
cyclophilin_ABH_like 139..297 CDD:238907 88/163 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447234
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.