DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppid

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001004279.1 Gene:Ppid / 361967 RGDID:1303174 Length:370 Species:Rattus norvegicus


Alignment Length:174 Identity:97/174 - (55%)
Similarity:117/174 - (67%) Gaps:4/174 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEY---RPDGVPIGYKGASFHRV 74
            :|.||.||||:.:|...:||::.|||||.||:||||||..||||.   ...|.|:.:||..|||:
  Rat    12 NSKNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGTGPTTGKPLHFKGCPFHRI 76

  Fly    75 IKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNF 139
            ||.||||||||...:|||..||||..|.||||..|||..|||||||:|..|||.|||||......
  Rat    77 IKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSMANAGPNTNGSQFFITTVPTPH 141

  Fly   140 LDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||||||||:|:.||.:.|.:|||........||.| |::||::
  Rat   142 LDGKHVVFGQVIKGLGVARMLENVEVNGEKPAKLCV-IAECGEL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 93/166 (56%)
PpidNP_001004279.1 cyclophilin_ABH_like 16..182 CDD:238907 93/166 (56%)
Chaperone activity. /evidence=ECO:0000250 185..215 97/174 (56%)
3a0801s09 192..>330 CDD:273380
Interaction with HSP90AB1. /evidence=ECO:0000250 214..370
TPR repeat 223..251 CDD:276809
TPR repeat 272..302 CDD:276809
TPR repeat 307..335 CDD:276809
TPR repeat 341..364 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.