DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppial4g

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_341364.2 Gene:Ppial4g / 361080 RGDID:1559682 Length:195 Species:Rattus norvegicus


Alignment Length:168 Identity:85/168 - (50%)
Similarity:104/168 - (61%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80
            |..:||:|......:||:..|||||.|||||||||...|||     ...||||:||||:|..||.
  Rat     3 NLTMFFNITADGEPLGRVSLELFADKVPRTAENFRSLTTGE-----KGFGYKGSSFHRIIPGFMC 62

  Fly    81 QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            |||.....:|||..||||..|.:::|.|||..||:|||||:|..|||.||||..||...||||.|
  Rat    63 QGGKVTCHNGTGGKSIYGEKFENDSFILKHTGPGILSMANAGPNTNGSQFFICTAKTERLDGKCV 127

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||:...|..|:..:|:..: .|.|....:|||.|||:
  Rat   128 VFGKGRGGTNIVEAMEHFGS-RNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 81/163 (50%)
Ppial4gXP_341364.2 cyclophilin 7..162 CDD:294131 81/160 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.