DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and ninaA

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_476656.1 Gene:ninaA / 33271 FlyBaseID:FBgn0002936 Length:237 Species:Drosophila melanogaster


Alignment Length:168 Identity:74/168 - (44%)
Similarity:103/168 - (61%) Gaps:8/168 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGV-PIGYKGASFHRVIKDFMIQG 82
            ::.|:......:||:.|.||....|:|..|||..|.     .|: ...|.|:.||||:..|::||
  Fly    29 IYMDVKHNKKPVGRITFGLFGKLAPKTVANFRHICL-----RGINGTSYVGSRFHRVVDRFLVQG 88

  Fly    83 GDFVQGDGTGVTSIYGNTFGDEN--FTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            ||.|.|||||..||||:.|.||:  ..::|:.||.|.|||.|.:||||||::|.....:|||||.
  Fly    89 GDIVNGDGTGSISIYGDYFPDEDKALAVEHNRPGYLGMANRGPDTNGCQFYVTTVGAKWLDGKHT 153

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||:||:|:..:..||:|.|..::.|..||.||.||::
  Fly   154 VFGKVLEGMDTIYAIEDVKTDTDDFPVEPVVISNCGEI 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 72/164 (44%)
ninaANP_476656.1 cyclophilin 27..189 CDD:294131 72/164 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 81 1.000 Domainoid score I449
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I362
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11071
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.