DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppie

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001382655.1 Gene:Ppie / 298508 RGDID:1311411 Length:301 Species:Rattus norvegicus


Alignment Length:171 Identity:92/171 - (53%)
Similarity:113/171 - (66%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 RSSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIK 76
            ::.:||.|:.||.:|....||:...|.:|.||.||||||..||.|     ...|:||:||||:|.
  Rat   135 KARSNPQVYMDIKIGNKPAGRIQMLLRSDVVPMTAENFRCLCTHE-----KGFGFKGSSFHRIIP 194

  Fly    77 DFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLD 141
            .||.|||||...:|||..||||..|.||||.|||..||||||||||..|||.|||:||.|.::||
  Rat   195 QFMCQGGDFTNHNGTGGKSIYGKKFDDENFILKHTGPGLLSMANSGPNTNGSQFFLTCDKTDWLD 259

  Fly   142 GKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQ 182
            |||||||.:.|||.::|:|| .....:.|||..|.|:.||:
  Rat   260 GKHVVFGEITDGLDVLRQIE-AQGSKDGKPKQKVIIADCGE 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 89/163 (55%)
PpieNP_001382655.1 RRM_PPIE 8..82 CDD:409783
cyclophilin_ABH_like 140..298 CDD:238907 89/163 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.