DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppif

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_758443.1 Gene:Ppif / 282819 RGDID:628670 Length:206 Species:Rattus norvegicus


Alignment Length:171 Identity:90/171 - (52%)
Similarity:116/171 - (67%) Gaps:6/171 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKD 77
            ||.||:|:.|:......:||::.||.||.||:||||||..||||     ...||||::|||||..
  Rat    41 SSQNPLVYLDVGADGQPLGRVVLELKADVVPKTAENFRALCTGE-----KGFGYKGSTFHRVIPA 100

  Fly    78 FMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDG 142
            ||.|.|||...:|||..||||:.|.||||||||..||:|||||:|..|||.||||...|.::|||
  Rat   101 FMCQAGDFTNHNGTGGKSIYGSRFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDG 165

  Fly   143 KHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            ||||||.|.:|:.:::|||:..: .:.|....:.|:.|||:
  Rat   166 KHVVFGHVKEGMDVVKKIESFGS-KSGKTSKKIVITDCGQL 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 84/163 (52%)
PpifNP_758443.1 cyclophilin_ABH_like 45..203 CDD:238907 84/163 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.