DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CG32236

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_729026.1 Gene:CG32236 / 249170 FlyBaseID:FBgn0046793 Length:385 Species:Drosophila melanogaster


Alignment Length:183 Identity:41/183 - (22%)
Similarity:73/183 - (39%) Gaps:45/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 PVVFFDIAVGTTE--IGRMIFELFADTVPRTAENFRQFCT----GEYR-----------PDGVPI 64
            |:::||:||....  :||::.:|:.:..|.....|.:..|    |.:|           .:.||.
  Fly   228 PIIYFDMAVRENNQFMGRLLLQLYTELSPEVVLEFVRMATHNDVGCHRFVRIFSNLWMEAELVPA 292

  Fly    65 GYKGASFHRVIK-DFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGC 128
            .:.....|..:| .|:         |.:.:|.:....:...    :|...||||...|.|:    
  Fly   293 VHDSLHNHHSVKYSFL---------DPSKITGVLSYPWDYR----RHFPQGLLSYTISFKQ---- 340

  Fly   129 QFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCG 181
                     :.:..:.|:||||..||.:::......| .|.|.|..|.:::||
  Fly   341 ---------SVIPWQRVIFGRVCGGLRVLQNCHEFGT-KNGKTKKTVIVTRCG 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 39/181 (22%)
CG32236NP_729026.1 KIAA1430 85..177 CDD:290590
cyclophilin 227..385 CDD:294131 41/183 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.