DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and CG30350

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_724715.1 Gene:CG30350 / 246556 FlyBaseID:FBgn0050350 Length:369 Species:Drosophila melanogaster


Alignment Length:195 Identity:38/195 - (19%)
Similarity:68/195 - (34%) Gaps:54/195 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SQLRSSNNPVVFFDIAV-GTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFH 72
            ::||....|.::||:.: ....:||.:.:|:.:..|...                         .
  Fly   205 AELRRLFRPRIYFDLYLKDARPLGRFVVQLYTEAAPLVV-------------------------L 244

  Fly    73 RVIKDFMI-QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDS--------------PGLLSMANSG 122
            ::||..|. |...|:      |..::.|.:.:.:..|..||              .|..|...|.
  Fly   245 QLIKSCMCNQHSKFM------VKRLFPNLWLETDLMLSSDSLLHQPLEYDAKVIDHGASSYVLSF 303

  Fly   123 KE------TNGCQFFITCAKCNFLDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCG 181
            .:      |:...|.|:......::|..|.|||::.|..|...|::..| .|.|....:..:.||
  Fly   304 SKAYVTGFTHHLSFAISFKPLTVVNGSRVGFGRIVKGSKICECIQSYGT-KNGKLSRGLLFTSCG 367

  Fly   182  181
              Fly   368  367

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 34/185 (18%)
CG30350NP_724715.1 KIAA1430 60..155 CDD:290590
cyclophilin 212..369 CDD:294131 36/188 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.