DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and PPIL2

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_011528343.1 Gene:PPIL2 / 23759 HGNCID:9261 Length:616 Species:Homo sapiens


Alignment Length:152 Identity:66/152 - (43%)
Similarity:85/152 - (55%) Gaps:11/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92
            |..|.:..||..|..|:|.|||.:.|...|        |.|..|||.|::|:||||| ..|.|||
Human   286 TNKGDLNLELHCDLTPKTCENFIRLCKKHY--------YDGTIFHRSIRNFVIQGGD-PTGTGTG 341

  Fly    93 VTSIYGNTFGDE-NFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLI 156
            ..|.:|..|.|| ...|.|...|:|||||||..:|..|||||...|.:||.||.:||||:.|..:
Human   342 GESYWGKPFKDEFRPNLSHTGRGILSMANSGPNSNRSQFFITFRSCAYLDKKHTIFGRVVGGFDV 406

  Fly   157 MRKIENVPTGP-NNKPKLPVTI 177
            :..:|||.:.| .::||..:.|
Human   407 LTAMENVESDPKTDRPKEEIRI 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 66/152 (43%)
PPIL2XP_011528343.1 RING-Ubox_PPIL2 38..110 CDD:319577
RING_Ubox 100..159 CDD:388418
U-box domain, a modified RING finger 103..146 CDD:319361
cyclophilin_RING 281..440 CDD:238904 66/152 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.