DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Y17G9B.4

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_500632.3 Gene:Y17G9B.4 / 177245 WormBaseID:WBGene00021201 Length:262 Species:Caenorhabditis elegans


Alignment Length:169 Identity:54/169 - (31%)
Similarity:80/169 - (47%) Gaps:17/169 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPD-GVPIGYKGASFHRVIKDFMIQG 82
            ||..:::|..|.|.::.:||.|.|||||:||..:||||.|.. |.|:..|......::...:|..
 Worm    99 VFIHVSIGGIEEGCIVIQLFNDIVPRTAQNFESWCTGEKRGKYGEPLHLKECEIKMILPGSVIGF 163

  Fly    83 GDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLD--GKHV 145
            |||.:.         ...|.||.....| ...:||| |..|..|...........:.:|  ||.:
 Worm   164 GDFEEN---------CEYFDDEKSKENH-CKNVLSM-NIDKSENSSAPLFNMELSDGVDRAGKAI 217

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNK-PKLPVTISQCGQM 183
            |||:|:.|..::.|:  :..|..:. |:..|.||.||:|
 Worm   218 VFGKVVMGNRVIEKV--LLAGSRDGIPEQTVKISDCGEM 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 51/165 (31%)
Y17G9B.4NP_500632.3 cyclophilin 99..252 CDD:294131 51/165 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
32.870

Return to query results.
Submit another query.