DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and cyn-4

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_496337.1 Gene:cyn-4 / 174674 WormBaseID:WBGene00000880 Length:523 Species:Caenorhabditis elegans


Alignment Length:139 Identity:62/139 - (44%)
Similarity:78/139 - (56%) Gaps:10/139 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 TEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMIQGGDFVQGDGTG 92
            |..|.:..||||..||:..|||...|:..|        |....|||:||:||:|||| ..|.|.|
 Worm   286 TNFGPLNLELFAPKVPKACENFITHCSNGY--------YNNTKFHRLIKNFMLQGGD-PTGTGHG 341

  Fly    93 VTSIYGNTFGDENFT-LKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHVVFGRVLDGLLI 156
            ..||:...|.||..: ..||:.|:|||||.|..|||.|||||...|.:||.||.:|||::.|...
 Worm   342 GESIWDKPFSDEFISGFSHDARGVLSMANKGSNTNGSQFFITFRPCKYLDRKHTIFGRLVGGQDT 406

  Fly   157 MRKIENVPT 165
            :..||.:.|
 Worm   407 LTTIEKLET 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 62/139 (45%)
cyn-4NP_496337.1 Ubox 45..96 CDD:128780
cyclophilin_RING 281..440 CDD:238904 62/139 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.