DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and PPIAL4H

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_001355057.1 Gene:PPIAL4H / 105371242 HGNCID:53889 Length:164 Species:Homo sapiens


Alignment Length:169 Identity:83/169 - (49%)
Similarity:105/169 - (62%) Gaps:10/169 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGE--YRPDGVPIGYKGASFHRVIKDF 78
            |.||||||.|....:||:..:||||.:|:||||||...|||  :|       |||:.|||:|..|
Human     3 NSVVFFDITVDGKPLGRISIKLFADKIPKTAENFRALSTGEKGFR-------YKGSCFHRIIPGF 60

  Fly    79 MIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGK 143
            |.|||||.:.:||...||||..|.|||...||...|:|||.|:|..|||.|.||..||..:||||
Human    61 MCQGGDFTRPNGTDDKSIYGEKFDDENLIRKHTGSGILSMVNAGPNTNGSQLFICTAKTEWLDGK 125

  Fly   144 HVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQ 182
            ||.||:|.:.:.|:..:|:... .|:|....:||:.|||
Human   126 HVAFGKVKERVNIVEAMEHFGY-RNSKTSKKITIADCGQ 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 79/165 (48%)
PPIAL4HNP_001355057.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.