DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and PPIH

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:NP_006338.1 Gene:PPIH / 10465 HGNCID:14651 Length:177 Species:Homo sapiens


Alignment Length:168 Identity:133/168 - (79%)
Similarity:151/168 - (89%) Gaps:0/168 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80
            |||||||:::|..|:|||..|||||.||:||||||||||||:|.|||||||||::||||||||||
Human    10 NPVVFFDVSIGGQEVGRMKIELFADVVPKTAENFRQFCTGEFRKDGVPIGYKGSTFHRVIKDFMI 74

  Fly    81 QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            ||||||.||||||.|||...|.||||.|:|.:||||||||||..||||||||||:||::||||||
Human    75 QGGDFVNGDGTGVASIYRGPFADENFKLRHSAPGLLSMANSGPSTNGCQFFITCSKCDWLDGKHV 139

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||:::||||:|||||||||||||||||||.|||||:|
Human   140 VFGKIIDGLLVMRKIENVPTGPNNKPKLPVVISQCGEM 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 129/163 (79%)
PPIHNP_006338.1 cyclophilin 8..177 CDD:412213 132/166 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142173
Domainoid 1 1.000 273 1.000 Domainoid score I1803
eggNOG 1 0.900 - - E1_COG0652
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H38172
Inparanoid 1 1.050 295 1.000 Inparanoid score I2765
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54618
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 1 1.000 - - FOG0005876
OrthoInspector 1 1.000 - - oto91125
orthoMCL 1 0.900 - - OOG6_103291
Panther 1 1.100 - - LDO PTHR11071
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R962
SonicParanoid 1 1.000 - - X4270
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.