DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Nktr

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_038938667.1 Gene:Nktr / 100364165 RGDID:2321593 Length:1516 Species:Rattus norvegicus


Alignment Length:172 Identity:84/172 - (48%)
Similarity:111/172 - (64%) Gaps:3/172 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SSNNPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEY---RPDGVPIGYKGASFHRV 74
            :.:.|...|||.:....:||::|:||:|..|:|.:||...|:||.   :..|..:.|||::||||
  Rat    62 AQDRPQCHFDIEINREPVGRIMFQLFSDICPKTCKNFLCLCSGEKGLGKTTGKKLCYKGSTFHRV 126

  Fly    75 IKDFMIQGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNF 139
            :|:||||||||.:|:|.|..||||..|.||||.||||...||||||.||.|||.|||||......
  Rat   127 VKNFMIQGGDFSEGNGKGGESIYGGYFKDENFILKHDRAFLLSMANRGKHTNGSQFFITTKPAPH 191

  Fly   140 LDGKHVVFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCG 181
            |||.|||||.|:.|..::.:|||:.|...::|...|.:..||
  Rat   192 LDGVHVVFGLVISGFEVIEQIENLKTDAASRPYADVRVIDCG 233

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 82/166 (49%)
NktrXP_038938667.1 cyclophilin 66..233 CDD:412213 82/166 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.