DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17266 and Ppial4d

DIOPT Version :9

Sequence 1:NP_001246149.1 Gene:CG17266 / 35571 FlyBaseID:FBgn0033089 Length:183 Species:Drosophila melanogaster
Sequence 2:XP_006250863.1 Gene:Ppial4d / 100360977 RGDID:2321083 Length:164 Species:Rattus norvegicus


Alignment Length:168 Identity:95/168 - (56%)
Similarity:113/168 - (67%) Gaps:6/168 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 NPVVFFDIAVGTTEIGRMIFELFADTVPRTAENFRQFCTGEYRPDGVPIGYKGASFHRVIKDFMI 80
            ||.|||||......:||:.||||||.||:||||||...|||     ...||||:||||:|..||.
  Rat     3 NPTVFFDITADGEPLGRVCFELFADKVPKTAENFRALSTGE-----KGFGYKGSSFHRIIPGFMC 62

  Fly    81 QGGDFVQGDGTGVTSIYGNTFGDENFTLKHDSPGLLSMANSGKETNGCQFFITCAKCNFLDGKHV 145
            |||||.:.:|||..||||..|.||||.|||..||:|||||:|..|||.||||..||..:||||||
  Rat    63 QGGDFTRHNGTGGKSIYGEKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHV 127

  Fly   146 VFGRVLDGLLIMRKIENVPTGPNNKPKLPVTISQCGQM 183
            |||:|.:|:.|:..:|...: .|.|....:|||.|||:
  Rat   128 VFGKVKEGMSIVEAMERFGS-RNGKTSKKITISDCGQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17266NP_001246149.1 cyclophilin_ABH_like 17..181 CDD:238907 91/163 (56%)
Ppial4dXP_006250863.1 cyclophilin_ABH_like 4..162 CDD:238907 91/163 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1403619at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.