DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP3 and pgap3

DIOPT Version :9

Sequence 1:NP_610223.1 Gene:PGAP3 / 35570 FlyBaseID:FBgn0033088 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001072247.1 Gene:pgap3 / 779696 XenbaseID:XB-GENE-947217 Length:316 Species:Xenopus tropicalis


Alignment Length:317 Identity:132/317 - (41%)
Similarity:183/317 - (57%) Gaps:22/317 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IVLLLGALVTACLASNGDRTQFFHNCRQNCERTNCSADGLEIQEQAVKF-YQQSVFDRLFQWSCA 72
            :||.|..:|.   ||.|||...:.:|...|||.||:...|      ..| .:|.::.|:..|:|.
 Frog     5 LVLFLAGVVA---ASRGDREPVYRDCVTLCERNNCTGSRL------TDFRAEQPLYMRVTGWTCL 60

  Fly    73 DECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRREVR 137
            |:|:|.|||.||..:.:.|..:|||:|||||.|.|..|||||.:.|.||.|..|.:|.::|..|.
 Frog    61 DDCRYQCMWYTVSLYLKEGHEVPQFHGKWPFSRFLFFQEPASALASFLNGVASLLMLLRYRSSVP 125

  Fly   138 PDSPCYMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMRMLH-RYSLF 201
            .....|.....|::.|:|.|.||.||||||..|||.:||..|.|:||.|:|:..||... :|...
 Frog   126 SSCQMYRTCLAFSMVSVNAWFWSTIFHTRDTALTEKMDYFCASSVILHSIYLCCMRTFGLQYPSI 190

  Fly   202 LRGVITLAFLSYYINYFA----YLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPY-FR 261
            ..|     |.::.:..||    ||::|||:|::||..|...||:..:.|..||...|..:|| ::
 Frog   191 ANG-----FGAFLVLLFACHVSYLTLGRFDYSYNMAANTGFGVLNLMWWLAWCFRRRFHQPYLWK 250

  Fly   262 RILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYDFMIEDCRTLRK 318
            .:|....|.:||: ||||||||::||||||||||.:|:||..|:|.|:.:|...|.|
 Frog   251 CVLVVISLQSLAL-LELLDFPPVMWILDAHALWHFSTVPLHFLFYSFLKDDSLYLLK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP3NP_610223.1 Per1 65..313 CDD:282000 111/253 (44%)
pgap3NP_001072247.1 Per1 49..301 CDD:367799 111/257 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 216 1.000 Domainoid score I2647
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5484
Inparanoid 1 1.050 236 1.000 Inparanoid score I3300
OMA 1 1.010 - - QHG59972
OrthoDB 1 1.010 - - D523376at33208
OrthoFinder 1 1.000 - - FOG0004451
OrthoInspector 1 1.000 - - oto103878
Panther 1 1.100 - - LDO PTHR13148
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R898
SonicParanoid 1 1.000 - - X3155
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.