DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PGAP3 and Pgap3

DIOPT Version :9

Sequence 1:NP_610223.1 Gene:PGAP3 / 35570 FlyBaseID:FBgn0033088 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001137367.1 Gene:Pgap3 / 688174 RGDID:1592386 Length:320 Species:Rattus norvegicus


Alignment Length:321 Identity:132/321 - (41%)
Similarity:188/321 - (58%) Gaps:15/321 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SAIVLLLGALVTACLASNGDRTQFFHNCRQNCERTNCSADGLEIQEQAVKFY--QQSVFDRLFQW 69
            :|.:|||...|....:|.|||...:.:|...||..|||.|       |:|.:  :|.::..|..|
  Rat     5 TAPLLLLTLAVGLAGSSQGDREPVYRDCVLRCEERNCSGD-------ALKHFRSRQPIYMSLAGW 62

  Fly    70 SCADECQYGCMWRTVFAFFERGWPIPQFYGKWPFLRLLGMQEPASVIFSCLNFVVHLRLLRKFRR 134
            :|.|:|:|.|||.||..:.:.|:.:|||:|||||.|.|.:|||||.:.|.||.:..|.:|.::|.
  Rat    63 TCRDDCKYECMWLTVGLYLQEGYRVPQFHGKWPFSRFLFIQEPASALASLLNGLASLVMLCRYRA 127

  Fly   135 EVRPDSPCYMLTHIFAVTSLNGWIWSAIFHTRDFPLTELLDYAFAYSIILCSLYVMVMR---MLH 196
            .|...||.|.....||..|||.|.||.:|||||..|||.:||..|.::||.|:|:..:|   :.|
  Rat   128 SVPASSPMYHTCMAFAWVSLNAWFWSTVFHTRDTDLTEKMDYFCASAVILHSVYLCCVRTVGLQH 192

  Fly   197 RYSLFLRGVITLAFLSYYINYFAYLSVGRFNYAFNMMVNVATGVIAAVGWFVWCHFVRTRRPYFR 261
            .......|.:.|..|:.:|   :|||:..|:|.:|||.|||.|::....|.|||.....|.|:.|
  Rat   193 PTVASAFGALLLLLLTGHI---SYLSLVHFDYGYNMMANVAIGLVNLAWWLVWCLRNHRRLPHTR 254

  Fly   262 RILRFYILMALAMSLELLDFPPILWILDAHALWHLATIPLASLYYDFMIEDCRTLRKEKAA 322
            |.:...:|:.....||||||||:.|:|||||:||::|||:.:|::.|:.:|...|.||..|
  Rat   255 RCMVVVVLLQGLSLLELLDFPPLFWVLDAHAIWHISTIPVHTLFFRFLEDDSLYLLKESEA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PGAP3NP_610223.1 Per1 65..313 CDD:282000 108/250 (43%)
Pgap3NP_001137367.1 Per1 54..305 CDD:397963 108/253 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166338215
Domainoid 1 1.000 220 1.000 Domainoid score I2541
eggNOG 1 0.900 - - E1_COG5237
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H5484
Inparanoid 1 1.050 246 1.000 Inparanoid score I3193
OMA 1 1.010 - - QHG59972
OrthoDB 1 1.010 - - D523376at33208
OrthoFinder 1 1.000 - - FOG0004451
OrthoInspector 1 1.000 - - oto97188
orthoMCL 1 0.900 - - OOG6_104144
Panther 1 1.100 - - LDO PTHR13148
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3155
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1514.810

Return to query results.
Submit another query.