DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9410 and ratA

DIOPT Version :10

Sequence 1:NP_724484.1 Gene:CG9410 / 35568 FlyBaseID:FBgn0033086 Length:242 Species:Drosophila melanogaster
Sequence 2:NP_417109.1 Gene:ratA / 945614 ECOCYCID:G7358 Length:158 Species:Escherichia coli


Alignment Length:132 Identity:32/132 - (24%)
Similarity:62/132 - (46%) Gaps:5/132 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 TKKELVGYSMQDMYSVVSDVSNYHKFVPYVKRSDVHSRGSEGFKADLIVGFPPLNEAYTSQVTLV 150
            ::..||.||.:.||.:|:||.:|.:|:|....|.:.........|.:.|....:::.:|::..|.
E. coli    18 SRTALVPYSAEQMYQLVNDVQSYPQFLPGCTGSRILESTPGQMTAAVDVSKAGISKTFTTRNQLT 82

  Fly   151 PPSLVKSECHDGRLFNYLLNEWSFKPGLKDIPNSCVLDFKVSFEF-KSLLHSNVANIFFDLICDQ 214
            ....:.....||. |..|:..|.|.|..::   :|.::|.:.||| ..|:......:|.:|..:.
E. coli    83 SNQSILMNLVDGP-FKKLIGGWKFTPLSQE---ACRIEFHLDFEFTNKLIELAFGRVFKELAANM 143

  Fly   215 ME 216
            ::
E. coli   144 VQ 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9410NP_724484.1 COQ10p_like 85..226 CDD:176855 32/132 (24%)
ratANP_417109.1 PRK10724 1..158 CDD:182678 32/132 (24%)

Return to query results.
Submit another query.