DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15908 and EMI1

DIOPT Version :9

Sequence 1:NP_610220.1 Gene:CG15908 / 35567 FlyBaseID:FBgn0033085 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_010800.3 Gene:EMI1 / 852125 SGDID:S000002920 Length:187 Species:Saccharomyces cerevisiae


Alignment Length:96 Identity:21/96 - (21%)
Similarity:36/96 - (37%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 DSKSDKSKESLDDAW-AIRPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNC----- 67
            :|...|.:|.:...: ....|....::...|.|...:|..|:.:|..|.|.:.::.::.|     
Yeast    87 ESSLRKKQERMSTKYPTTMSCREAFDQLTSCYSIGGQFRSYYRYGDFTSCDKQVSKFKFCIIHGN 151

  Fly    68 ------ERY--QQSNGNDVAAGKAVIKSEEE 90
                  |.|  |.||...:.....||..|.|
Yeast   152 DPVKVQEWYKDQVSNNKALENTSGVIWQERE 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15908NP_610220.1 DUF3128 28..108 CDD:288218 18/76 (24%)
EMI1NP_010800.3 DUF3128 104..181 CDD:402775 16/76 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR28052
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.