DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15908 and 2510002D24Rik

DIOPT Version :9

Sequence 1:NP_610220.1 Gene:CG15908 / 35567 FlyBaseID:FBgn0033085 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001028336.1 Gene:2510002D24Rik / 72307 MGIID:1919557 Length:105 Species:Mus musculus


Alignment Length:101 Identity:35/101 - (34%)
Similarity:57/101 - (56%) Gaps:7/101 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEE 90
            |||.:|:.|::.|.|.....|.|::.||..||.|||.|..||..:::|...:  |.:::.:||: 
Mouse    11 RPCEVYRAEWELCRSVGHVLHHYYVHGKRPDCRQWLRDLTNCREWEESRSAE--AQRSLCESEQ- 72

  Fly    91 RRRIRLRAHFAND-TWQKRKKPPLDWAAPLPDWMEK 125
               :|::|...:. .|..|::||.||..|||...:|
Mouse    73 ---VRVQAAQKHTLVWALRQRPPTDWNLPLPQEKDK 105

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15908NP_610220.1 DUF3128 28..108 CDD:288218 24/80 (30%)
2510002D24RikNP_001028336.1 DUF3128 13..88 CDD:288218 24/80 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167849374
Domainoid 1 1.000 52 1.000 Domainoid score I11464
eggNOG 1 0.900 - - E1_2D1HI
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5280
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006928
OrthoInspector 1 1.000 - - oto94014
orthoMCL 1 0.900 - - OOG6_108946
Panther 1 1.100 - - LDO PTHR28052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5057
SonicParanoid 1 1.000 - - X5021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.780

Return to query results.
Submit another query.