DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15908 and LOC498122

DIOPT Version :9

Sequence 1:NP_610220.1 Gene:CG15908 / 35567 FlyBaseID:FBgn0033085 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_001102528.1 Gene:LOC498122 / 498122 RGDID:1595717 Length:105 Species:Rattus norvegicus


Alignment Length:95 Identity:32/95 - (33%)
Similarity:52/95 - (54%) Gaps:5/95 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEE 90
            |||.:|:.|::.|.|.....:.|::.|:..||.|||.|..:|..:::|...:  |.:::.:||:.
  Rat    11 RPCEVYRAEWELCRSAGHVLYHYYVHGERPDCRQWLRDLTSCREWEESRSAE--AQRSLCESEQT 73

  Fly    91 RRRIRLRAHFANDTWQKRKKPPLDWAAPLP 120
            |.:   .|......|..||:||.||..|||
  Rat    74 RVQ---AAQKHTLIWALRKRPPADWNLPLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15908NP_610220.1 DUF3128 28..108 CDD:288218 21/79 (27%)
LOC498122NP_001102528.1 DUF3128 13..88 CDD:402775 21/79 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166352997
Domainoid 1 1.000 47 1.000 Domainoid score I11725
eggNOG 1 0.900 - - E1_2D1HI
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5250
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541651at2759
OrthoFinder 1 1.000 - - FOG0006928
OrthoInspector 1 1.000 - - oto97544
orthoMCL 1 0.900 - - OOG6_108946
Panther 1 1.100 - - LDO PTHR28052
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.800

Return to query results.
Submit another query.