DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15908 and C22orf39

DIOPT Version :9

Sequence 1:NP_610220.1 Gene:CG15908 / 35567 FlyBaseID:FBgn0033085 Length:156 Species:Drosophila melanogaster
Sequence 2:NP_776154.4 Gene:C22orf39 / 128977 HGNCID:27012 Length:105 Species:Homo sapiens


Alignment Length:96 Identity:31/96 - (32%)
Similarity:44/96 - (45%) Gaps:7/96 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSEEE 90
            |||..|:.|:..|.|.:...|.|::.|:...|.||..|..:|..:::....:......    |.|
Human    11 RPCEAYRAEWKLCRSARHFLHHYYVHGERPACEQWQRDLASCRDWEERRNAEAQQSLC----ESE 71

  Fly    91 RRRIR-LRAHFANDTWQKRKKPPLDWAAPLP 120
            |.|:| .|.|..  .|..|:.||.||..|||
Human    72 RARVRAARKHIL--VWAPRQSPPPDWHLPLP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15908NP_610220.1 DUF3128 28..108 CDD:288218 21/80 (26%)
C22orf39NP_776154.4 DUF3128 13..88 CDD:402775 21/80 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165158991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D1HI
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 61 1.000 Inparanoid score I5389
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541651at2759
OrthoFinder 1 1.000 - - FOG0006928
OrthoInspector 1 1.000 - - oto90430
orthoMCL 1 0.900 - - OOG6_108946
Panther 1 1.100 - - LDO PTHR28052
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5057
SonicParanoid 1 1.000 - - X5021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1211.830

Return to query results.
Submit another query.