DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15908 and c22orf39

DIOPT Version :9

Sequence 1:NP_610220.1 Gene:CG15908 / 35567 FlyBaseID:FBgn0033085 Length:156 Species:Drosophila melanogaster
Sequence 2:XP_004910632.1 Gene:c22orf39 / 100485616 XenbaseID:XB-GENE-6032457 Length:106 Species:Xenopus tropicalis


Alignment Length:103 Identity:33/103 - (32%)
Similarity:44/103 - (42%) Gaps:19/103 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPCHLYKEEYDDCTSFKARFHQYFIFGKDTDCSQWLTDYRNCERYQQSNGNDVAAGKAVIKSE-- 88
            |.|..|..|:..|.|.:..||.|:..||..:|.:|..||..|..::::            |||  
 Frog    11 RDCDDYWSEWKHCKSLRNHFHNYYTHGKAPECQEWKRDYMTCRDWEKT------------KSELL 63

  Fly    89 ----EERRRIRLRAHFAND-TWQKRKKPPLDWAAPLPD 121
                ::..|.||.....|. .|..||.||.||..||.|
 Frog    64 KETLQQSERTRLEGKRNNSPVWTLRKNPPPDWYLPLDD 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15908NP_610220.1 DUF3128 28..108 CDD:288218 23/86 (27%)
c22orf39XP_004910632.1 DUF3128 10..88 CDD:371469 24/88 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5201
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1541651at2759
OrthoFinder 1 1.000 - - FOG0006928
OrthoInspector 1 1.000 - - oto104235
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5021
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.970

Return to query results.
Submit another query.