DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and TOM70

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_014278.3 Gene:TOM70 / 855602 SGDID:S000005065 Length:617 Species:Saccharomyces cerevisiae


Alignment Length:424 Identity:85/424 - (20%)
Similarity:139/424 - (32%) Gaps:167/424 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 KLKYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFF 141
            |..:..||  :|:.||..|:.||.:.::||:..||..:...::.|.|     .|.|:|.||.:..
Yeast    87 KANFTAEE--KDKYALALKDKGNQFFRNKKYDDAIKYYNWALELKED-----PVFYSNLSACYVS 144

  Fly   142 IKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERF--------------DLCTQMCEELLE- 191
            :.:.:..:..:.:||..||||:|...|.|.....|.:|              |......|.:|| 
Yeast   145 VGDLKKVVEMSTKALELKPDYSKVLLRRASANEGLGKFADAMFDLSVLSLNGDFNDASIEPMLER 209

  Fly   192 --------------VDVDNEVAI--------ALLHKNKMKKL---------------EIERNQRK 219
                          .|:|...|.        |...|:|.:.|               |:......
Yeast   210 NLNKQAMSKLKEKFGDIDTATATPTELSTQPAKERKDKQENLPSVTSMASFFGIFKPELTFANYD 274

  Fly   220 EAAEA------------KRRLTRFHRLRDAIEQRAIKFDDQ--KVGKKDVLSEELLYP------- 263
            |:.||            ||....:.:..::..:.|..|::|  |..:.:.|.|:|...       
Yeast   275 ESNEADKELMNGLSNLYKRSPESYDKADESFTKAARLFEEQLDKNNEDEKLKEKLAISLEHTGIF 339

  Fly   264 KFL---PLEDH--------------------------------------PVHLDEDGSTL----- 282
            |||   ||..|                                      .:.||.:.|::     
Yeast   340 KFLKNDPLGAHEDIKKAIELFPRVNSYIYMALIMADRNDSTEYYNYFDKALKLDSNNSSVYYHRG 404

  Fly   283 --------------------------IWP----AAFSYP-------EFLYSDFYQQLPETTTMRD 310
                                      |:|    |..:|.       |.|:|:..::.||...:.:
Yeast   405 QMNFILQNYDQAGKDFDKAKELDPENIFPYIQLACLAYRENKFDDCETLFSEAKRKFPEAPEVPN 469

  Fly   311 CLATLLTEKLPYDKA-HNYRLGNVHVYYENRKVG 343
            ..|.:||:|..:||| ..|.|.   :..||:..|
Yeast   470 FFAEILTDKNDFDKALKQYDLA---IELENKLDG 500

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 28/94 (30%)
TPR repeat 91..119 CDD:276809 9/27 (33%)
TPR repeat 124..158 CDD:276809 7/33 (21%)
TPR repeat 163..191 CDD:276809 7/41 (17%)
TPR repeat 197..227 CDD:276809 10/64 (16%)
TOM70NP_014278.3 3a0801s09 1..614 CDD:273380 85/424 (20%)
TPR repeat 99..127 CDD:276809 9/27 (33%)
TPR repeat 131..161 CDD:276809 8/34 (24%)
TPR repeat 166..189 CDD:276809 5/22 (23%)
TPR repeat 330..358 CDD:276809 6/27 (22%)
TPR repeat 363..391 CDD:276809 0/27 (0%)
TPR repeat 396..426 CDD:276809 1/29 (3%)
TPR repeat 431..459 CDD:276809 7/27 (26%)
TPR repeat 465..493 CDD:276809 9/30 (30%)
TPR repeat 498..537 CDD:276809 1/3 (33%)
TPR repeat 542..567 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345404
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.