DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and TTC12

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:XP_005271661.1 Gene:TTC12 / 54970 HGNCID:23700 Length:777 Species:Homo sapiens


Alignment Length:404 Identity:82/404 - (20%)
Similarity:148/404 - (36%) Gaps:97/404 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 QKAWTDEERLELAAQLDAELDAFIDGLEKKRYEEGWPEDRWQEEMDKHPFFMKRAPQPGDDVHPM 71
            |||..:.|:..|..:.|.|.|.....|.|..........:..||::...|               
Human    35 QKAVLETEKRLLLMEEDQEEDECRTTLNKTMISPPQTAMKSAEEINSEAF--------------- 84

  Fly    72 FEGLQKLKYDPEENTRDE-----LALNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVL 131
               |..::.|.:|..:..     ||...||.||.......:..||..::||::...|    :.||
Human    85 ---LASVEKDAKERAKRRRENKVLADALKEKGNEAFAEGNYETAILRYSEGLEKLKD----MKVL 142

  Fly   132 YNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFDLCTQMCEELLEVDVDN 196
            |.||:.|:..:::|..:|.|.:.||......|||.:...:....|:.:.:..:..:::||::...
Human   143 YTNRAQAYMKLEDYEKALVDCEWALKCDEKCTKAYFHMGKANLALKNYSVSRECYKKILEINPKL 207

  Fly   197 EVAIALLHKNKMKKLEIERN---QRKEAAEAKRRLTRFHRLRDAIEQRAIKFDDQKVGKKDVLSE 258
            :..:    |..:.:::::..   |.|||          |.|.|:.:..|       |..|::| |
Human   208 QTQV----KGYLNQVDLQEKADLQEKEA----------HELLDSGKNTA-------VTTKNLL-E 250

  Fly   259 ELLYPKFLPLEDHPVHLDEDGSTLIWPAAFSYPE---FLYSDFYQQLPETTTMRDCLATLLTEKL 320
            .|..|..:||      ....|..::........|   |...:.:..:.:...:|.|.:|      
Human   251 TLSKPDQIPL------FYAGGIEILTEMINECTEQTLFRMHNGFSIISDNEVIRRCFST------ 303

  Fly   321 PYDKAHNYRLGNVHV------------------YYENRKVGCVHKVDEEKQLAEIIAEKGFFV-- 365
                     .||..|                  ..||::|..:|. |..:.||.:::.|...:  
Human   304 ---------AGNDAVEEMVCVSVLKLWQAVCSRNEENQRVLVIHH-DRARLLAALLSSKVLAIRQ 358

  Fly   366 SGGALLFYVVHKDS 379
            ...|||.::...:|
Human   359 QSFALLLHLAQTES 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 27/99 (27%)
TPR repeat 91..119 CDD:276809 9/27 (33%)
TPR repeat 124..158 CDD:276809 11/33 (33%)
TPR repeat 163..191 CDD:276809 4/27 (15%)
TPR repeat 197..227 CDD:276809 5/32 (16%)
TTC12XP_005271661.1 TPR_11 106..171 CDD:290150 21/68 (31%)
BamD 106..>164 CDD:276939 19/61 (31%)
TPR repeat 106..138 CDD:276939 9/31 (29%)
TPR repeat 106..134 CDD:276809 9/27 (33%)
TPR repeat 139..169 CDD:276809 11/29 (38%)
TPR_11 142..205 CDD:290150 16/62 (26%)
TPR_1 143..173 CDD:278916 9/29 (31%)
TPR repeat 174..202 CDD:276809 4/27 (15%)
TPR repeat 211..236 CDD:276809 7/38 (18%)
ARM 526..631 CDD:237987
armadillo repeat 555..591 CDD:293788
armadillo repeat 597..631 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.