| Sequence 1: | NP_001260729.1 | Gene: | Dpit47 / 35565 | FlyBaseID: | FBgn0266518 | Length: | 396 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001303425.1 | Gene: | unc-45 / 44910 | FlyBaseID: | FBgn0010812 | Length: | 947 | Species: | Drosophila melanogaster |
| Alignment Length: | 196 | Identity: | 52/196 - (26%) |
|---|---|---|---|
| Similarity: | 89/196 - (45%) | Gaps: | 18/196 - (9%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 93 NYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALF 157
Fly 158 YKPDYTKARWRSAQCAYE-LERFDLCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIERNQRKEA 221
Fly 222 AEAKRRLTRFHRLRDAIEQRAIKFDDQKVGKKDVLSEELLYPKFLPLEDH---------PVHLDE 277
Fly 278 D 278 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Dpit47 | NP_001260729.1 | 3a0801s09 | 84..>179 | CDD:273380 | 30/86 (35%) |
| TPR repeat | 91..119 | CDD:276809 | 6/25 (24%) | ||
| TPR repeat | 124..158 | CDD:276809 | 11/33 (33%) | ||
| TPR repeat | 163..191 | CDD:276809 | 12/28 (43%) | ||
| TPR repeat | 197..227 | CDD:276809 | 4/29 (14%) | ||
| unc-45 | NP_001303425.1 | TPR_11 | 12..81 | CDD:290150 | 19/66 (29%) |
| TPR repeat | 16..41 | CDD:276809 | 6/24 (25%) | ||
| TPR repeat | 46..79 | CDD:276809 | 11/33 (33%) | ||
| TPR_11 | 50..115 | CDD:290150 | 23/65 (35%) | ||
| TPR | 50..83 | CDD:197478 | 11/32 (34%) | ||
| UNC45-central | 351..494 | CDD:288539 | |||
| ARM | 668..788 | CDD:237987 | |||
| armadillo repeat | 753..789 | CDD:293788 | |||
| armadillo repeat | 795..826 | CDD:293788 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45462441 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.840 | |||||