DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and CG6980

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_651289.1 Gene:CG6980 / 42955 FlyBaseID:FBgn0039228 Length:250 Species:Drosophila melanogaster


Alignment Length:183 Identity:40/183 - (21%)
Similarity:78/183 - (42%) Gaps:24/183 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LEKKRYEEGWPEDRWQEEMDKHPFFMKRAPQPGDDVHPMFEGLQKLKYDPEENTRDELALNYKED 97
            :.:|..||  ..::..::|::..|.    .|...|.:...|...|.:|:.|..         :..
  Fly    85 INRKSLEE--DNEKQVKDMNQKSFM----EQVEKDANDRAEARAKAEYEAELQ---------RSQ 134

  Fly    98 GNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDY 162
            ||...:.:|:..||..:.:.|....|:    |:.|.||:..:..::||:.:|.|.|..|....:.
  Fly   135 GNEAFRSQKYEKAILHYDKAIIKVKDS----AITYCNRALCYIKLQNYKRALKDCQYVLEKLQES 195

  Fly   163 TKARWRSAQCAYE-LERFDLCTQMCEELLEVDVDNEVAIALLHKNKMKKLEIE 214
            ....|.....||: |::.|   :..|.:::....|...:|.:.| .:|:||.:
  Fly   196 NLRAWLYQAHAYKGLKQDD---KFEESVVKAREHNPKQLAYIDK-YIKQLEAD 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 21/95 (22%)
TPR repeat 91..119 CDD:276809 5/27 (19%)
TPR repeat 124..158 CDD:276809 10/33 (30%)
TPR repeat 163..191 CDD:276809 6/28 (21%)
TPR repeat 197..227 CDD:276809 5/18 (28%)
CG6980NP_651289.1 TPR_11 127..190 CDD:290150 17/75 (23%)
TPR repeat 128..156 CDD:276809 6/36 (17%)
TPR repeat 161..192 CDD:276809 10/34 (29%)
TPR_1 162..190 CDD:278916 9/27 (33%)
TPR repeat 197..225 CDD:276809 6/30 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R218
SonicParanoid 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.