DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and CG14894

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001262636.1 Gene:CG14894 / 41993 FlyBaseID:FBgn0038428 Length:263 Species:Drosophila melanogaster


Alignment Length:215 Identity:54/215 - (25%)
Similarity:90/215 - (41%) Gaps:46/215 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EGLQKLKYD--PEENTRD-ELALNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVL------ 128
            |.|::.:.|  ||:.|.: |.|...|.:||...|:.....|..::||.:       |:.      
  Fly    73 EELREREKDLSPEQLTANKEKADKLKVEGNELFKNDDAEGAAKTYTEAL-------DICPSASSK 130

  Fly   129 --AVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFDLCTQMCEELLE 191
              ||||.||:||...::..::::.|..:|:...|:|.:...|.|: .||.|      ...:|.||
  Fly   131 ERAVLYGNRAAAKIKLEANKAAIDDCTKAIELWPEYVRVLLRRAK-LYEQE------DKPDEALE 188

  Fly   192 VDVDNEVAIALLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQRAIKFDDQKVGKKDVL 256
                          :..|..||:..| :||.||:.||.      ..|.:|..|..::.:.....|
  Fly   189 --------------DYKKVTEIDPGQ-QEAREAQIRLP------PIINERNEKLKNEMMSSLKDL 232

  Fly   257 SEELLYPKFLPLEDHPVHLD 276
            ...:|.|..|..::..:..|
  Fly   233 GNMILKPFGLSTQNFQMQQD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 28/103 (27%)
TPR repeat 91..119 CDD:276809 8/27 (30%)
TPR repeat 124..158 CDD:276809 11/41 (27%)
TPR repeat 163..191 CDD:276809 6/27 (22%)
TPR repeat 197..227 CDD:276809 8/29 (28%)
CG14894NP_001262636.1 TPR_11 93..164 CDD:290150 19/77 (25%)
TPR repeat 94..122 CDD:276809 8/34 (24%)
TPR_11 132..198 CDD:290150 23/86 (27%)
TPR repeat 132..162 CDD:276809 10/29 (34%)
TPR_1 133..166 CDD:278916 11/32 (34%)
TPR 167..198 CDD:197478 11/51 (22%)
TPR repeat 167..195 CDD:276809 9/48 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462440
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.