DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and Sgt

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_001246058.1 Gene:Sgt / 35052 FlyBaseID:FBgn0032640 Length:331 Species:Drosophila melanogaster


Alignment Length:191 Identity:49/191 - (25%)
Similarity:87/191 - (45%) Gaps:22/191 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 MFEGLQKL--KYDPEENTRDELALNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYN 133
            |||..|.|  :.:||...   ||.:.|.:||..||..|:..|:..:...|.....||    :.|.
  Fly    97 MFELFQSLYTERNPESLA---LAESIKNEGNRLMKENKYNEALLQYNRAIAFDPKNP----IFYC 154

  Fly   134 NRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWRSAQCAYELERFDLCTQMCEELLEVDVDNEV 198
            ||:|||..:.....:::|.:.||.|..:|:||..|.......:..|:...|...:.:|::.||||
  Fly   155 NRAAAHIRLGENERAVTDCKSALVYNNNYSKAYCRLGVAYSNMGNFEKAEQAYAKAIELEPDNEV 219

  Fly   199 AIALLHKNKMKKLEIERNQRKEAAEAKRRLTRFHRLRDAIEQRAIK--FDDQKVGKKDVLS 257
                 :|:.::.....|||..:....:..|.      :.:.|..::  |::.::..:.:||
  Fly   220 -----YKSNLEAARNARNQPPQTGRLREDLI------NMLSQPMVRNLFNNAEIDVEQLLS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 26/94 (28%)
TPR repeat 91..119 CDD:276809 8/27 (30%)
TPR repeat 124..158 CDD:276809 11/33 (33%)
TPR repeat 163..191 CDD:276809 5/27 (19%)
TPR repeat 197..227 CDD:276809 6/29 (21%)
SgtNP_001246058.1 SGTA_dimer 9..>48 CDD:293154
TPR_11 116..177 CDD:290150 18/64 (28%)
TPR_2 116..149 CDD:285020 9/32 (28%)
TPR repeat 116..144 CDD:276809 8/27 (30%)
TPR_17 139..170 CDD:290167 9/34 (26%)
TPR repeat 149..179 CDD:276809 11/33 (33%)
TPR_16 156..218 CDD:290168 16/61 (26%)
TPR_1 184..217 CDD:278916 6/32 (19%)
TPR repeat 184..212 CDD:276809 5/27 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462411
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.