DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and STUB1

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_477441.1 Gene:STUB1 / 34433 FlyBaseID:FBgn0027052 Length:289 Species:Drosophila melanogaster


Alignment Length:260 Identity:50/260 - (19%)
Similarity:88/260 - (33%) Gaps:90/260 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRAL 156
            |..||.||.....:|:..||..:::.|.....|    |..:.||:..:..:|.:.....|::|||
  Fly    15 LQLKEQGNCLFAARKYDDAINCYSKAIIKNPTN----ATYFTNRALCNLKLKRWELCCQDSRRAL 75

  Fly   157 FYKPDYTKARWRSAQCAYELERFDLCTQ---------------------------------MCEE 188
            ....:..|..:...|...|::.||...:                                 :.||
  Fly    76 DIDGNLLKGHFFLGQGLMEIDNFDEAIKHLQRAYDLSKEQKQNFGDDITLQLRLARKKRWNVMEE 140

  Fly   189 ---------------LLEVDVDNEVAIALLHKN------KMKKLEI------------------- 213
                           |::.|:::.:|...|:.|      |.|:.||                   
  Fly   141 KRIQQEIELQSYLNGLIKGDMESRLANLKLNGNVHDEQLKDKQQEIEQECDDHIKELNNIFSKVD 205

  Fly   214 ERNQRKEAAEAKRRLTRFHRLRDAI--------EQRAIKFDDQKVGKKD-----VLSEELLYPKF 265
            ||.:::|..:.......|..|.|.:        |::.|:...|:||..|     .|:::.|.|.|
  Fly   206 ERRKKREVPDFLCGKISFEILTDPVITPSGITYERKDIEEHLQRVGHFDPVTRVKLTQDQLIPNF 270

  Fly   266  265
              Fly   271  270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 21/86 (24%)
TPR repeat 91..119 CDD:276809 8/26 (31%)
TPR repeat 124..158 CDD:276809 9/33 (27%)
TPR repeat 163..191 CDD:276809 8/75 (11%)
TPR repeat 197..227 CDD:276809 10/54 (19%)
STUB1NP_477441.1 TPR_11 17..78 CDD:290150 17/64 (27%)
TPR 17..47 CDD:197478 8/29 (28%)
TPR repeat 17..42 CDD:276809 7/24 (29%)
TPR repeat 47..77 CDD:276809 9/33 (27%)
TPR repeat 82..110 CDD:276809 5/27 (19%)
U-box 213..285 CDD:252675 13/58 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462436
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.