Sequence 1: | NP_001260729.1 | Gene: | Dpit47 / 35565 | FlyBaseID: | FBgn0266518 | Length: | 396 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_477441.1 | Gene: | STUB1 / 34433 | FlyBaseID: | FBgn0027052 | Length: | 289 | Species: | Drosophila melanogaster |
Alignment Length: | 260 | Identity: | 50/260 - (19%) |
---|---|---|---|
Similarity: | 88/260 - (33%) | Gaps: | 90/260 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 92 LNYKEDGNFYMKHKKFRMAIYSFTEGIKTKTDNPDVLAVLYNNRSAAHFFIKNYRSSLSDAQRAL 156
Fly 157 FYKPDYTKARWRSAQCAYELERFDLCTQ---------------------------------MCEE 188
Fly 189 ---------------LLEVDVDNEVAIALLHKN------KMKKLEI------------------- 213
Fly 214 ERNQRKEAAEAKRRLTRFHRLRDAI--------EQRAIKFDDQKVGKKD-----VLSEELLYPKF 265
Fly 266 265 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dpit47 | NP_001260729.1 | 3a0801s09 | 84..>179 | CDD:273380 | 21/86 (24%) |
TPR repeat | 91..119 | CDD:276809 | 8/26 (31%) | ||
TPR repeat | 124..158 | CDD:276809 | 9/33 (27%) | ||
TPR repeat | 163..191 | CDD:276809 | 8/75 (11%) | ||
TPR repeat | 197..227 | CDD:276809 | 10/54 (19%) | ||
STUB1 | NP_477441.1 | TPR_11 | 17..78 | CDD:290150 | 17/64 (27%) |
TPR | 17..47 | CDD:197478 | 8/29 (28%) | ||
TPR repeat | 17..42 | CDD:276809 | 7/24 (29%) | ||
TPR repeat | 47..77 | CDD:276809 | 9/33 (27%) | ||
TPR repeat | 82..110 | CDD:276809 | 5/27 (19%) | ||
U-box | 213..285 | CDD:252675 | 13/58 (22%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462436 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |