DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dpit47 and SPAC2F3.02

DIOPT Version :9

Sequence 1:NP_001260729.1 Gene:Dpit47 / 35565 FlyBaseID:FBgn0266518 Length:396 Species:Drosophila melanogaster
Sequence 2:NP_594381.1 Gene:SPAC2F3.02 / 2541463 PomBaseID:SPAC2F3.02 Length:192 Species:Schizosaccharomyces pombe


Alignment Length:167 Identity:42/167 - (25%)
Similarity:70/167 - (41%) Gaps:39/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 KHPFFMKRAPQPGDDVHPMFEGLQKLKYDPEENTRDELALN-----YKEDGNFYMKHKKFRMA-- 110
            |:|||:   |.|               |.|   .:..:||:     .|:..|...|.||:..|  
pombe    40 KYPFFI---PPP---------------YPP---AKPNMALSTQVNKMKQTANEAFKRKKYEEAKK 83

  Fly   111 IY--SFTEGIKTKTDNPDVL-----AVLYNNRSAAHFFIKNYRSSLSDAQRALFYKPDYTKARWR 168
            :|  :....:...|..|.:|     :|:..||:||...:..:..:|:||..||..:.:|.|..:|
pombe    84 LYGLALQLALNRCTWEPSILTREEASVMLCNRAAAEIALSQFPEALADANAALKIRNNYGKCYYR 148

  Fly   169 SAQCAYELERFDLCTQMCEE---LLEVDVDNEVAIAL 202
            .|:....:.|.:...|:..:   |.|....||: :||
pombe   149 KAKALEAMHRIEEAKQVVRDGLILAEPVTRNEL-VAL 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dpit47NP_001260729.1 3a0801s09 84..>179 CDD:273380 26/108 (24%)
TPR repeat 91..119 CDD:276809 9/36 (25%)
TPR repeat 124..158 CDD:276809 12/38 (32%)
TPR repeat 163..191 CDD:276809 6/30 (20%)
TPR repeat 197..227 CDD:276809 3/6 (50%)
SPAC2F3.02NP_594381.1 TPR repeat 95..138 CDD:276809 13/42 (31%)
ENDO3c 104..>184 CDD:304925 20/80 (25%)
TPR repeat 143..170 CDD:276809 5/26 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR46035
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.