powered by:
Protein Alignment geminin and Mcidas
DIOPT Version :9
Sequence 1: | NP_001260727.1 |
Gene: | geminin / 35563 |
FlyBaseID: | FBgn0033081 |
Length: | 192 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001033003.1 |
Gene: | Mcidas / 622408 |
MGIID: | 3648807 |
Length: | 379 |
Species: | Mus musculus |
Alignment Length: | 134 |
Identity: | 34/134 - (25%) |
Similarity: | 60/134 - (44%) |
Gaps: | 40/134 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 77 PAIST---------KDA--DTQTDAEAV---PLGNADKPITAEDLTSTAE--------------- 112
|::.| :|| |...|:.:: ||.|:|.|.:..|::|...
Mouse 104 PSLQTEEDFNLQNFRDAMDDLIADSSSLMSPPLTNSDFPFSPCDVSSFGSCLSPSLDPPALGSPD 168
Fly 113 ----PGENYYKLLAEQRRLALEDSLTENRHLHERIEGLEEEMDTMRQ---ELDE----AKNLVEV 166
|.|.|:|.:|:|.:.||..:|.||..||..:...:||:.::|: :|.| .::|..|
Mouse 169 LPPPPTEQYWKEVADQNQRALGTALIENNQLHVTLTQKQEEIASLRERNVQLKELASRTRHLASV 233
Fly 167 LKEI 170
|.::
Mouse 234 LDKL 237
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C167834816 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2C45P |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR13372 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
4 | 3.890 |
|
Return to query results.
Submit another query.