DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment geminin and GMNN

DIOPT Version :9

Sequence 1:NP_001260727.1 Gene:geminin / 35563 FlyBaseID:FBgn0033081 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001238918.1 Gene:GMNN / 51053 HGNCID:17493 Length:209 Species:Homo sapiens


Alignment Length:204 Identity:56/204 - (27%)
Similarity:89/204 - (43%) Gaps:50/204 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ETEAEQKEHLKQQ---RQTLKPLQGNVNDKENLTGSGRASIVDQLSRLKAGVQVAPKYGKRKCVD 74
            :.:.|.||::|..   |:|||.:|          .|...|:|.:.:.|.||:      .|||   
Human     7 QKQEEIKENIKNSSVPRRTLKMIQ----------PSASGSLVGRENELSAGL------SKRK--- 52

  Fly    75 TAPAISTKDADTQTDAE---AVPLGNADK---PITAE--DLTSTAEPGENYYKLLAEQRRLALED 131
                 ...|..|.|.:.   .||..:.:|   .:|.|  ||.....|...|:|.:||:||.||.:
Human    53 -----HRNDHLTSTTSSPGVIVPESSENKNLGGVTQESFDLMIKENPSSQYWKEVAEKRRKALYE 112

  Fly   132 SLTENRHLHERIEGLEEEMDTMR---QELDEAKNLVEVLKEICEE------------DNSEVEED 181
            :|.||..||:.||..:.|:..::   :||.|....|:.:.|:.|.            ||.|.:.:
Human   113 ALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSE 177

  Fly   182 DTTGDEDKV 190
            :.|.::..|
Human   178 EETVEDSLV 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gemininNP_001260727.1 Geminin 25..188 CDD:284760 51/188 (27%)
GMNNNP_001238918.1 Geminin 1..184 CDD:399999 55/200 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..79 24/95 (25%)
Necessary and sufficient for interaction with IDAS and CDT1. /evidence=ECO:0000269|PubMed:21543332 82..161 27/78 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..209 5/23 (22%)
Homeodomain binding 170..190 5/17 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165144702
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2C45P
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5479
Isobase 1 0.950 - 0 Normalized mean entropy S7949
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631696at2759
OrthoFinder 1 1.000 - - FOG0009565
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR13372
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5103
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
109.840

Return to query results.
Submit another query.