DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment geminin and gmnn

DIOPT Version :9

Sequence 1:NP_001260727.1 Gene:geminin / 35563 FlyBaseID:FBgn0033081 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001034825.1 Gene:gmnn / 496859 XenbaseID:XB-GENE-966994 Length:219 Species:Xenopus tropicalis


Alignment Length:219 Identity:61/219 - (27%)
Similarity:90/219 - (41%) Gaps:67/219 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 EAEQ-----KEHLKQQ-------RQTLKPLQGNVN------DKENLTGSGRASI-VDQLSRLKAG 60
            :|||     |.:|..:       |:|||.:|.:.:      .||.:..|.:..: .|||:..||.
 Frog    10 DAEQPTMSIKSYLVNKTNEALAPRRTLKVIQPSASGCLVGRTKEPVKNSTKRKLWNDQLTSKKAK 74

  Fly    61 VQVAPKYGKRKCVDTAPAISTKDADTQTDAEAVPLGNADKPITAEDLTSTAEPGENYYKLLAEQR 125
            |:||.....|:         .||..::                |.||.....|...|:|.:||:|
 Frog    75 VEVAVDLEHRE---------NKDCSSE----------------AYDLMIKETPTYLYWKEVAEER 114

  Fly   126 RLALEDSLTENRHLHERIEGLEEEMDTMRQELDEAKNL---------------------VEVLKE 169
            |.||.::|.||..||:.||..:||:..::||.||...|                     :|.||.
 Frog   115 RKALYEALQENEKLHKEIELKDEEIGRLKQENDELMELAGHVQYMANMIERLTGNAPRSLEDLKN 179

  Fly   170 I-CEEDNSEVEEDDTTGD-EDKVN 191
            : .||...|.|.|...|. ||:.:
 Frog   180 LDLEEARFEDEADMADGRLEDETD 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gemininNP_001260727.1 Geminin 25..188 CDD:284760 54/199 (27%)
gmnnNP_001034825.1 Geminin 1..190 CDD:369354 56/204 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1631696at2759
OrthoFinder 1 1.000 - - FOG0009565
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.