DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment geminin and gmn-1

DIOPT Version :9

Sequence 1:NP_001260727.1 Gene:geminin / 35563 FlyBaseID:FBgn0033081 Length:192 Species:Drosophila melanogaster
Sequence 2:NP_001379042.1 Gene:gmn-1 / 176651 WormBaseID:WBGene00013552 Length:180 Species:Caenorhabditis elegans


Alignment Length:172 Identity:42/172 - (24%)
Similarity:76/172 - (44%) Gaps:30/172 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 QGNVNDKENLTGSGRASIVDQL-------SRLKAGVQVAPKYGKRKCVDTAPAISTKDADTQTDA 90
            |.|.:.:.:..||.:|:...|:       ::||....:.|. .........|.:|..|.....|.
 Worm     8 QLNNSARNSPFGSEKATGTKQIPEPLKLTAQLKKYQPITPS-PLASATTITPVLSPFDVFCDDDQ 71

  Fly    91 EA------------------VPLGNADKPITAEDLTSTAEPGENYYKLLAEQRRLALEDSLTENR 137
            ||                  :.:.:....||..|||| .:|..||.:::|::.::.|:|.:..|:
 Worm    72 EAKNVETQMFEYGTVSTQTIINVPHVQPKITEADLTS-EKPTVNYLRVMADRLQMDLDDEMDRNQ 135

  Fly   138 HLHERIEGLEEEMDTMRQELDEAKNLVEVLKEICEEDNSEVE 179
            .|...:..|:|:   ||:..|:.:.|:|||.:|.||..::.|
 Worm   136 RLVAELGDLDEK---MRKIDDDTEILLEVLADIDEEQQTDEE 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gemininNP_001260727.1 Geminin 25..188 CDD:284760 42/172 (24%)
gmn-1NP_001379042.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_122582
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.