DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment geminin and gmnc

DIOPT Version :9

Sequence 1:NP_001260727.1 Gene:geminin / 35563 FlyBaseID:FBgn0033081 Length:192 Species:Drosophila melanogaster
Sequence 2:XP_009290113.1 Gene:gmnc / 100148564 ZFINID:ZDB-GENE-121211-1 Length:382 Species:Danio rerio


Alignment Length:96 Identity:24/96 - (25%)
Similarity:40/96 - (41%) Gaps:8/96 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 CVDTAPAISTKDADTQTDA---EAVPLGNADKPITAEDLTSTAEPGENYYKLLAEQRRLALEDSL 133
            |..|: |..:.|..|.|..   :|.||.||.:........|..|.|..:.....:|    |...|
Zfish    18 CASTS-ADGSVDVSTTTLVSLWDAGPLDNAARQHEPPRRDSLLESGLGHQPTWHDQ----LSPQL 77

  Fly   134 TENRHLHERIEGLEEEMDTMRQELDEAKNLV 164
            ..|:.|.:.:...|||:..:::|.::.|..:
Zfish    78 QRNKQLQDTLMQREEELARLQEENNKLKEFL 108

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gemininNP_001260727.1 Geminin 25..188 CDD:284760 24/96 (25%)
gmncXP_009290113.1 Geminin <77..>106 CDD:284760 7/28 (25%)
DUF4472 93..>170 CDD:291409 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170577892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13372
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.