DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fmo-2 and AT1G63390

DIOPT Version :9

Sequence 1:NP_610217.1 Gene:Fmo-2 / 35561 FlyBaseID:FBgn0033079 Length:429 Species:Drosophila melanogaster
Sequence 2:NP_001319303.1 Gene:AT1G63390 / 842645 AraportID:AT1G63390 Length:168 Species:Arabidopsis thaliana


Alignment Length:146 Identity:49/146 - (33%)
Similarity:78/146 - (53%) Gaps:17/146 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VDKRRVCVIGAGTAGLCALKNSLEAGLDAVAYERGTEIGGTWIFSEEMPKDEY------DEVHSS 64
            :....|.|||||.|||.|.:.....|...|.:||..::|||||:::.:..|..      ..||||
plant     8 IRSHHVAVIGAGAAGLVAARELRREGHSVVVFERQKQVGGTWIYTDHIEPDPLSVDPTRSVVHSS 72

  Fly    65 MYEGLRTNLPKEVMGYPDYSY--PDDITES-----FITSNQVLEFLRSYAEHFKLKAHIKLQHEV 122
            :|..||||||:|.|||.|:.:  ...::||     |.:..:||.:|:.:|:.|.::..|:....|
plant    73 VYGSLRTNLPRECMGYRDFPFVVRSGVSESRDPRRFPSHGEVLAYLQDFAKEFAIEEMIRFDTAV 137

  Fly   123 IRVRPRLDD----WEV 134
            ::|.|..::    |.:
plant   138 VKVAPAAEEGSGKWRI 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fmo-2NP_610217.1 NADB_Rossmann 12..214 CDD:304358 48/140 (34%)
AT1G63390NP_001319303.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 150 1.000 Domainoid score I1415
eggNOG 1 0.900 - - E1_COG2072
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D405736at2759
OrthoFinder 1 1.000 - - FOG0000093
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.