DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15233 and CG33710

DIOPT Version :9

Sequence 1:NP_610214.2 Gene:CG15233 / 35556 FlyBaseID:FBgn0033076 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001027137.1 Gene:CG33710 / 3772611 FlyBaseID:FBgn0053710 Length:162 Species:Drosophila melanogaster


Alignment Length:134 Identity:28/134 - (20%)
Similarity:50/134 - (37%) Gaps:27/134 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AIVLLLMPGTFCQ-CIDCNAHW-----KFH--------------CKTNLTGFYCAPGAYVHQWVV 54
            |:|:|......|: .|..|:.:     ||:              | ||:...:.:.|...|  ..
  Fly     4 ALVILYTISFVCEGAISVNSTFEKGIRKFYNTADHSQGFPICGNC-TNIKNVHISTGFTCH--FE 65

  Fly    55 PEEDYHSDLKGFNTPFSACTPFPLEIS-YIETFCCLYSPSIGCQLALNPGIFNKEKLPVRRCKDC 118
            .|....:.....:..::.|.|....|: .::.:||.:||:.||...:...:|:|..   ..|..|
  Fly    66 DERQVENKFGETDDKYAPCVPKDYVINGEVKNYCCFWSPTSGCSALIGRLLFDKSS---DYCDTC 127

  Fly   119 IEHC 122
            ...|
  Fly   128 KGSC 131



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462406
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0007611
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.