Sequence 1: | NP_610214.2 | Gene: | CG15233 / 35556 | FlyBaseID: | FBgn0033076 | Length: | 166 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001027137.1 | Gene: | CG33710 / 3772611 | FlyBaseID: | FBgn0053710 | Length: | 162 | Species: | Drosophila melanogaster |
Alignment Length: | 134 | Identity: | 28/134 - (20%) |
---|---|---|---|
Similarity: | 50/134 - (37%) | Gaps: | 27/134 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 10 AIVLLLMPGTFCQ-CIDCNAHW-----KFH--------------CKTNLTGFYCAPGAYVHQWVV 54
Fly 55 PEEDYHSDLKGFNTPFSACTPFPLEIS-YIETFCCLYSPSIGCQLALNPGIFNKEKLPVRRCKDC 118
Fly 119 IEHC 122 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C45462406 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0007611 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.930 |