DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pld and Pld6

DIOPT Version :9

Sequence 1:NP_001137610.1 Gene:Pld / 35554 FlyBaseID:FBgn0286511 Length:1364 Species:Drosophila melanogaster
Sequence 2:XP_220517.1 Gene:Pld6 / 287366 RGDID:1311987 Length:222 Species:Rattus norvegicus


Alignment Length:109 Identity:29/109 - (26%)
Similarity:50/109 - (45%) Gaps:29/109 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 GIAVRAITHWNYASISRGRTSILTRLQEAGIANPENYISFHSLRNHSFLNNTPITELIYVHSKLL 1185
            |:.||.||..:|.:::..:..:   |::|||          .:|:..        :|.|:|.|..
  Rat   115 GVRVRVITDCDYMALNGSQIGL---LRKAGI----------QVRHDQ--------DLGYMHHKFA 158

  Fly  1186 IADDRVVICGSANINDRSMIGKR-------DSEIAAILMDEEFE 1222
            |.|.:|:|.||.|...:::...|       |:|...:.: ||||
  Rat   159 IVDKKVLITGSLNWTTQAIQNNRENVLIMEDTEYVRLFL-EEFE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PldNP_001137610.1 PX_PLD 230..431 CDD:132805
PH_PLD 419..564 CDD:269956
PLDc_vPLD1_2_yPLD_like_1 590..734 CDD:197236
PLDc_vPLD1_2_yPLD_like_2 1032..1220 CDD:197239 25/105 (24%)
Pld6XP_220517.1 PLDc_vPLD6_like 93..204 CDD:197268 29/109 (27%)
PLDc_2 94..204 CDD:289836 29/109 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1502
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.