DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin3 and CG1239

DIOPT Version :9

Sequence 1:NP_001260724.1 Gene:bin3 / 35552 FlyBaseID:FBgn0263144 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001287185.1 Gene:CG1239 / 40706 FlyBaseID:FBgn0037368 Length:300 Species:Drosophila melanogaster


Alignment Length:357 Identity:123/357 - (34%)
Similarity:167/357 - (46%) Gaps:113/357 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   766 LEPAKIPPIKMLPKFRA---------DGLKYRYGNFDRYVDFRQMN-EFRDVRLQVFQRHVELFE 820
            :|....||.:. ||.|.         ..|.::|||:..|...|.:| :|.|:||.|.....:||.
  Fly    46 VEATSRPPAQS-PKKRLHLNGKPMQNKDLNFKYGNYKHYYGKRILNKDFHDIRLDVLGTQPDLFR 109

  Fly   821 NKDILDIGCNVGHMTITVARHLAPKTIVGIDIDRELVARARRNLSIFVRIPKEEKLLEVKAEPTV 885
            ||.:||||||.||::|.:||....|::||:||||.|:..|::.:|..                  
  Fly   110 NKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQKTVSHL------------------ 156

  Fly   886 DAKANIAVKDETSGAAHKKTRRGKRRRKVHQGIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPI 950
                                   ||.....|||.|                              
  Fly   157 -----------------------KRHATPGQGIPH------------------------------ 168

  Fly   951 SFPLTYGRIPRILSSSKSPNMLGNKNQFPANVFFRHTNYVLKDESLMASDTQQYDLILCLSVTKW 1015
                                           :.|.|.||||:|:.|:..:..|:|:|||||||||
  Fly   169 -------------------------------IQFVHGNYVLEDDVLLEIERPQFDVILCLSVTKW 202

  Fly  1016 IHLNFGDNGLKMAFKRMFNQLRPGGKLILEAQNWASYKKKKNLTPEIYNNYKQIEFFPNKFHEYL 1080
            |||||.|:|||.||:||:.|||||||||||.|::..||::|.|:.:|.:||..|:|.|:.|.|||
  Fly   203 IHLNFCDSGLKQAFRRMYLQLRPGGKLILEPQSFDGYKRRKKLSEQIRDNYNAIKFRPDHFTEYL 267

  Fly  1081 LSSEVGFSHSYTLGVPRHMNKGFCRPIQLYAK 1112
            ||.||||:....:|:|.|...||.||||::.|
  Fly   268 LSPEVGFAEMKLMGIPEHCKVGFKRPIQIFTK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bin3NP_001260724.1 Methyltransf_18 820..>867 CDD:289607 23/46 (50%)
Bin3 1004..1112 CDD:284317 64/107 (60%)
CG1239NP_001287185.1 Methyltransf_18 109..233 CDD:289607 71/225 (32%)
Bin3 191..299 CDD:284317 64/107 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459122
Domainoid 1 1.000 87 1.000 Domainoid score I2751
eggNOG 1 0.900 - - E1_KOG2899
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.928771 Normalized mean entropy S5203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109677at6656
OrthoFinder 1 1.000 - - FOG0003359
OrthoInspector 1 1.000 - - otm3386
orthoMCL 1 0.900 - - OOG6_103556
Panther 1 1.100 - - P PTHR12315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2246
1110.700

Return to query results.
Submit another query.