DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin3 and CG11342

DIOPT Version :9

Sequence 1:NP_001260724.1 Gene:bin3 / 35552 FlyBaseID:FBgn0263144 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_647896.1 Gene:CG11342 / 38538 FlyBaseID:FBgn0035537 Length:238 Species:Drosophila melanogaster


Alignment Length:341 Identity:62/341 - (18%)
Similarity:103/341 - (30%) Gaps:156/341 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly   788 RYGNFDRYVDFRQMNEFRDVRLQVFQRHVELFENKD------------------ILDIGCNVGHM 834
            :||||..|..|....|           .|:|..:.|                  |||:|||.|.:
  Fly    12 QYGNFFNYYQFSSAAE-----------RVKLLPDADIWLPALEDGETQKDKPYFILDVGCNCGVL 65

  Fly   835 TITVARHLAPK-----TIVGIDIDRELVARARRNLSIFVRIPKEEKLLEVKAEPTVDAKANIAVK 894
            |..:.::|..:     .::|:|||..|:.||.                |....|...:.|.:.|.
  Fly    66 TQLMHKYLEERLHRSVKVLGVDIDPRLIQRAS----------------EENESPKDVSYACVDVL 114

  Fly   895 DETSGAAHKKTRRGKRRRKVHQGIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPISFPLTYGRI 959
            |:.:                             .|.::...::|:|                   
  Fly   115 DDEA-----------------------------FESVKTYMEVNNL------------------- 131

  Fly   960 PRILSSSKSPNMLGNKNQFPANVFFRHTNYVLKDESLMASDTQQYDLILCLSVTKWIHLNFGDNG 1024
                                                      :::|.|.|.|:|.|||||..|.|
  Fly   132 ------------------------------------------EKFDAICCYSITMWIHLNHHDQG 154

  Fly  1025 LKMAFKRMFNQLRPGGKLILEAQNWASYKKKKNLTPEIYNNYKQIEFFPNKFHEYLLSSEVGFSH 1089
            |:...:::.|...   .|::|.|.|..|:|.:....      |..|.||       |..|:.:..
  Fly   155 LRFFLQKLSNLAE---LLVVEPQPWKCYQKAERRLK------KAGEIFP-------LFLELKWRS 203

  Fly  1090 SYTLGVPRHMNKGFCR 1105
            ...|.:.:::.:...|
  Fly   204 DVDLQIQKYLEESLDR 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bin3NP_001260724.1 Methyltransf_18 820..>867 CDD:289607 17/69 (25%)
Bin3 1004..1112 CDD:284317 28/102 (27%)
CG11342NP_647896.1 Methyltransf_12 56..165 CDD:285454 36/214 (17%)
AdoMet_MTases 134..238 CDD:302624 28/102 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459123
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2899
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.