DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin3 and Bcdin3d

DIOPT Version :9

Sequence 1:NP_001260724.1 Gene:bin3 / 35552 FlyBaseID:FBgn0263144 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_001102221.1 Gene:Bcdin3d / 363001 RGDID:1306433 Length:285 Species:Rattus norvegicus


Alignment Length:287 Identity:66/287 - (22%)
Similarity:95/287 - (33%) Gaps:134/287 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   789 YGNFDRYVDFRQMNEFRDVRLQVFQRHV--ELF-----ENKDI--LDIGCNVGHMTITVARH-LA 843
            :|||..|..|....:    ||::....:  :||     |.:.|  ||:|||.|.:::.:.:| |:
  Rat    31 FGNFPHYSRFHPPEQ----RLRLLPPELLRQLFPPEGPERRPILGLDVGCNSGDLSMALYKHFLS 91

  Fly   844 P---KTIVG---------IDIDRELVARARRNLSIFVRIPKEEKLLEVKAEPTVDAKANIAVKDE 896
            |   :|..|         .|||..||.||...    .|.|.....:      |:|      :.|:
  Rat    92 PHDGETSSGTSRELRLLCCDIDPVLVERAENG----CRFPDALTFI------TLD------IMDQ 140

  Fly   897 TSGAAHKKTRRGKRRRKVHQGIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPISFPLTYGRIPR 961
            .|             |||                     .|:|.|                    
  Rat   141 ES-------------RKV---------------------PLSSFL-------------------- 151

  Fly   962 ILSSSKSPNMLGNKNQFPANVFFRHTNYVLKDESLMASDTQQYDLILCLSVTKWIHLNFGDNGLK 1026
                          :||..:||                     |::.|:|||.|||||.||.|| 
  Rat   152 --------------SQFGRSVF---------------------DIVFCMSVTMWIHLNHGDRGL- 180

  Fly  1027 MAFKRMFNQLRPGGKLILEAQNWASYK 1053
            ..|....:.|  ...|::|.|.|..|:
  Rat   181 CEFLAHVSSL--CSYLLVEPQPWKCYR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bin3NP_001260724.1 Methyltransf_18 820..>867 CDD:289607 20/61 (33%)
Bin3 1004..1112 CDD:284317 21/50 (42%)
Bcdin3dNP_001102221.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AdoMet_MTases 72..>167 CDD:302624 36/199 (18%)
S-adenosyl-L-methionine binding. /evidence=ECO:0000250|UniProtKB:Q7Z5W3 136..137 1/6 (17%)
Bin3 159..264 CDD:284317 22/71 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1185441at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.