DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment bin3 and SPBC2A9.10

DIOPT Version :9

Sequence 1:NP_001260724.1 Gene:bin3 / 35552 FlyBaseID:FBgn0263144 Length:1367 Species:Drosophila melanogaster
Sequence 2:NP_596220.1 Gene:SPBC2A9.10 / 2540331 PomBaseID:SPBC2A9.10 Length:268 Species:Schizosaccharomyces pombe


Alignment Length:336 Identity:92/336 - (27%)
Similarity:140/336 - (41%) Gaps:93/336 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   787 YRYGNFDRYVDFRQMNEFRDVRLQVFQRHVELFENKDILDIGCNVGHMTITVARHLAPKTIVGID 851
            :::||:..|...|......|.||:....  .||....:||||||.|.::..:|.......::|:|
pombe     4 FQHGNYHSYYSMRGGTSIIDPRLKCLPD--SLFYEASVLDIGCNNGTVSAQIASIFGASFVLGLD 66

  Fly   852 IDRELVARARRNLSIFVRIPKEEKLLEVKAEPTVDAKANIAVKDETSGAAHKKTRRGKRRRKVHQ 916
            ||..|:.:||::|. ||                                   .:|.|..|..   
pombe    67 IDHVLIQKARKHLE-FV-----------------------------------SSRIGPVRNP--- 92

  Fly   917 GIHHHHHHHHDLEQLQQQQKLNSLLVKPHEFFPISFPLTYGRIPRILSSSKSPNMLGNKNQFPAN 981
                                 .|::.....::|||....:.|||..|    .|.:  ||..||.|
pombe    93 ---------------------GSIVEDQFNYYPISSIKKFSRIPVQL----QPPL--NKQNFPHN 130

  Fly   982 VFFRHTNYVLKDESLMASDTQQYDLILCLSVTKWIHLNFGDNGLKMAFKRMFNQLRPGGKLILEA 1046
            :.|...:: |:.||     .:::.:||.|||:||:|||..|.|:...|.::.:.|...|.||||.
pombe   131 IEFETADF-LRWES-----KRKFKIILALSVSKWVHLNNHDEGIIKFFGKISSLLETNGVLILEP 189

  Fly  1047 QNWASYKK--KK----NLTPEIYNNYKQIEFFPNKFHEYLLSSEVGFSHSYTLGVPRHMN---KG 1102
            |.|.||.|  ||    |.|||      .::..|:.| |:|| ::.|....|:: .|:..|   |.
pombe   190 QGWDSYLKAAKKISVFNQTPE------NLKIQPDAF-EHLL-NQAGLVLEYSI-EPQVNNSEYKN 245

  Fly  1103 FC-RPIQLYAK 1112
            |. |.:.:|.|
pombe   246 FAKRTMYIYKK 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
bin3NP_001260724.1 Methyltransf_18 820..>867 CDD:289607 16/46 (35%)
Bin3 1004..1112 CDD:284317 43/117 (37%)
SPBC2A9.10NP_596220.1 Methyltransf_18 36..189 CDD:289607 57/224 (25%)
Bin3 147..256 CDD:284317 43/117 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 62 1.000 Domainoid score I2940
eggNOG 1 0.900 - - E1_KOG2899
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003359
OrthoInspector 1 1.000 - - otm47046
orthoMCL 1 0.900 - - OOG6_103556
Panther 1 1.100 - - LDO PTHR12315
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2246
TreeFam 00.000 Not matched by this tool.
98.810

Return to query results.
Submit another query.