Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001076388.1 | Gene: | zgc:162948 / 797781 | ZFINID: | ZDB-GENE-070424-46 | Length: | 288 | Species: | Danio rerio |
Alignment Length: | 268 | Identity: | 81/268 - (30%) |
---|---|---|---|
Similarity: | 122/268 - (45%) | Gaps: | 36/268 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 136 ETVDFESLDFQDSSHSEHDIPSYWESSVDSGSLNTPHHQPETAELFAVEPPTPPESSEEPAPDAA 200
Fly 201 EKPKMRRARPRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCE 265
Fly 266 ECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKS 330
Fly 331 WPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNL 395
Fly 396 NNHMVRLH 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
C2H2 Zn finger | 234..255 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 264..285 | CDD:275368 | 8/20 (40%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 7/19 (37%) | ||
zf-C2H2_8 | 305..373 | CDD:292531 | 28/67 (42%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 366..389 | CDD:290200 | 11/22 (50%) | ||
C2H2 Zn finger | 382..403 | CDD:275368 | 6/20 (30%) | ||
zgc:162948 | NP_001076388.1 | C2H2 Zn finger | 69..89 | CDD:275370 | 3/21 (14%) |
COG5048 | <94..257 | CDD:227381 | 67/192 (35%) | ||
C2H2 Zn finger | 97..117 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 125..145 | CDD:275368 | 8/20 (40%) | ||
zf-H2C2_2 | 137..160 | CDD:290200 | 9/23 (39%) | ||
C2H2 Zn finger | 153..173 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 169..190 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 181..201 | CDD:275368 | 7/19 (37%) | ||
zf-H2C2_2 | 193..218 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 209..229 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 237..257 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 265..283 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |