DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and Zfp322a

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001128556.1 Gene:Zfp322a / 680201 RGDID:1594230 Length:399 Species:Rattus norvegicus


Alignment Length:172 Identity:71/172 - (41%)
Similarity:97/172 - (56%) Gaps:9/172 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   232 HPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTERPFGCQHC 296
            :.|.:|||.|..:..|..|. ..|. |:..|.|:.|.|||.....|..|.:| |:.|:|:.|..|
  Rat    98 YKCSKCEKSFWHHLALSGHQ-RTHA-GKKFYTCDICGKNFGQSSDLLVHQRS-HTGEKPYLCNEC 159

  Fly   297 DRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAF 361
            |:.|...|.|:.|.|||||| ||  |:|..|.|::..||||.:|.|:|..  |||:||::|.|::
  Rat   160 DKCFSRSTNLIRHRRTHTGE-KP--FKCLECEKAFSGKSDLISHQRTHTG--ERPYKCNKCEKSY 219

  Fly   362 FTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403
            ..|.....|..|||||||:.|..|:||:....:|..|. |:|
  Rat   220 RHRSAFIVHKRVHTGEKPYKCSACEKCFGQKSDLIVHQ-RIH 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 7/20 (35%)
C2H2 Zn finger 264..285 CDD:275368 8/20 (40%)
C2H2 Zn finger 293..313 CDD:275368 8/19 (42%)
zf-C2H2_8 305..373 CDD:292531 30/67 (45%)
C2H2 Zn finger 324..344 CDD:275368 9/19 (47%)
C2H2 Zn finger 354..374 CDD:275368 5/19 (26%)
zf-H2C2_2 366..389 CDD:290200 11/22 (50%)
C2H2 Zn finger 382..403 CDD:275368 7/20 (35%)
Zfp322aNP_001128556.1 COG5048 <68..218 CDD:227381 53/127 (42%)
C2H2 Zn finger 72..92 CDD:275368
C2H2 Zn finger 100..120 CDD:275368 7/20 (35%)
C2H2 Zn finger 128..148 CDD:275368 8/20 (40%)
zf-H2C2_2 140..165 CDD:290200 10/25 (40%)
C2H2 Zn finger 156..176 CDD:275368 8/19 (42%)
zf-H2C2_2 168..192 CDD:290200 14/26 (54%)
C2H2 Zn finger 184..204 CDD:275368 9/19 (47%)
C2H2 Zn finger 212..232 CDD:275368 5/19 (26%)
C2H2 Zn finger 240..260 CDD:275368 7/20 (35%)
C2H2 Zn finger 268..288 CDD:275368
C2H2 Zn finger 294..314 CDD:275368
C2H2 Zn finger 322..344 CDD:275368
C2H2 Zn finger 352..372 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24409
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.