Sequence 1: | NP_610211.1 | Gene: | CG30431 / 35549 | FlyBaseID: | FBgn0050431 | Length: | 418 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003200031.1 | Gene: | zgc:171901 / 556292 | ZFINID: | ZDB-GENE-080220-13 | Length: | 381 | Species: | Danio rerio |
Alignment Length: | 245 | Identity: | 78/245 - (31%) |
---|---|---|---|
Similarity: | 125/245 - (51%) | Gaps: | 25/245 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 TPHHQPETAELFAVEPPTPPESSE--------EPAPDAAEKPKMRRARPRQDNVKPKERKAS--- 223
Fly 224 GAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQCEECRKNFASRHSLRYHVKSVHSTE 288
Fly 289 RPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRCSKSWPTKSDLRTHMRSHNPNMERPFK 353
Fly 354 CDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLH 403 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30431 | NP_610211.1 | zf-AD | 11..82 | CDD:285071 | |
C2H2 Zn finger | 234..255 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 264..285 | CDD:275368 | 6/20 (30%) | ||
C2H2 Zn finger | 293..313 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2_8 | 305..373 | CDD:292531 | 23/67 (34%) | ||
C2H2 Zn finger | 324..344 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 354..374 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 366..389 | CDD:290200 | 13/22 (59%) | ||
C2H2 Zn finger | 382..403 | CDD:275368 | 7/20 (35%) | ||
zgc:171901 | XP_003200031.1 | COG5048 | <38..272 | CDD:227381 | 69/224 (31%) |
C2H2 Zn finger | 88..108 | CDD:275368 | 7/20 (35%) | ||
zf-H2C2_2 | 100..125 | CDD:290200 | 10/26 (38%) | ||
C2H2 Zn finger | 116..136 | CDD:275368 | 6/20 (30%) | ||
zf-H2C2_2 | 128..153 | CDD:290200 | 10/25 (40%) | ||
C2H2 Zn finger | 144..164 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 172..192 | CDD:275368 | 7/19 (37%) | ||
C2H2 Zn finger | 200..220 | CDD:275368 | 6/19 (32%) | ||
zf-H2C2_2 | 212..236 | CDD:290200 | 13/23 (57%) | ||
C2H2 Zn finger | 228..248 | CDD:275368 | 7/20 (35%) | ||
C2H2 Zn finger | 256..276 | CDD:275368 | |||
C2H2 Zn finger | 284..304 | CDD:275368 | |||
zf-H2C2_2 | 296..321 | CDD:290200 | |||
C2H2 Zn finger | 312..332 | CDD:275368 | |||
zf-H2C2_2 | 324..349 | CDD:290200 | |||
C2H2 Zn finger | 340..360 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |