DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30431 and znf989

DIOPT Version :9

Sequence 1:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster
Sequence 2:NP_001018578.1 Gene:znf989 / 553777 ZFINID:ZDB-GENE-050522-337 Length:381 Species:Danio rerio


Alignment Length:202 Identity:77/202 - (38%)
Similarity:101/202 - (50%) Gaps:35/202 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   226 VHPRSLH-PCPECEKKFTRNFQLKLHMT---------------------------AVHGMGEMRY 262
            ||....| .||:|.|.|.:...|||||.                           .:|. ||..|
Zfish   125 VHTSERHYSCPQCAKGFRQKQHLKLHMRIHSGEKPFPCNQCGKRFNQLQALQSHFTIHS-GERPY 188

  Fly   263 QCEECRKNFASRHSLRYHVKSVHSTERPFGCQHCDRRFILRTQLLSHLRTHTGEAKPRIFECQRC 327
            .|.:|.|:|..|.||..|:| |||.|:||.|..|...|..:.:|.:|:|.|||| ||  |.|..|
Zfish   189 ACTQCEKSFRQRPSLEKHLK-VHSREKPFTCSQCGNGFTQKERLQNHMRIHTGE-KP--FACPHC 249

  Fly   328 SKSWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFFTRGHLNSHLLVHTGEKPFACEYCDKCYQSV 392
            .|::..:|:|..|:|:|:.  |:||.|..|.|:|..:..|..|:..|||||||||:.|.|.:...
Zfish   250 EKTFAHRSNLYFHVRTHSG--EKPFVCTHCGKSFRCKNSLVGHMRTHTGEKPFACDQCGKSFSRE 312

  Fly   393 GNLNNHM 399
            .||..||
Zfish   313 FNLKCHM 319

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG30431NP_610211.1 zf-AD 11..82 CDD:285071
C2H2 Zn finger 234..255 CDD:275368 10/47 (21%)
C2H2 Zn finger 264..285 CDD:275368 9/20 (45%)
C2H2 Zn finger 293..313 CDD:275368 6/19 (32%)
zf-C2H2_8 305..373 CDD:292531 27/67 (40%)
C2H2 Zn finger 324..344 CDD:275368 7/19 (37%)
C2H2 Zn finger 354..374 CDD:275368 6/19 (32%)
zf-H2C2_2 366..389 CDD:290200 13/22 (59%)
C2H2 Zn finger 382..403 CDD:275368 7/18 (39%)
znf989NP_001018578.1 C2H2 Zn finger 78..98 CDD:275368
zf-H2C2_2 90..115 CDD:290200